PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0799s0004.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 366aa    MW: 40626 Da    PI: 9.1259
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0799s0004.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32237290255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Kalax.0799s0004.3.p 237 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 290
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.5E-29234290IPR009057Homeodomain-like
SuperFamilySSF466892.69E-15235290IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-24237290IPR006447Myb domain, plants
PfamPF002496.2E-7238289IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MELFPAQPDL SLLISPPSST TKPNHTALLW PHTSRSSDHE QVVDEEDQEQ NSDLGFWNRA  60
LNNNNPSTIL SKQQTGPNPA PSNISFSNPS IRVSSSSSPK SSNITYFPHH QLLHTSPLPN  120
PNNLHNQATM IAQNQEQLSY MNMKPIRGIP IYHQNSAHRR HPFTASTFPH QHQSLLLDSI  180
PSLPSSISNT KSCSSINGSL ASPASCFQSS HHQNYHNGFV RSRFLSRFPV KKNTRAPRMR  240
WTSTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKTTDRAAAT  300
SDAYENGSSG DNSEDMMLDF QSSARKQSDQ LHQQSISSAA GRPNAQQDKD CQALWSNSSR  360
LEPSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015898005.11e-82PREDICTED: probable transcription factor KAN2 isoform X3
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-50G2-like family protein